PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.5763s0021.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family GeBP
Protein Properties Length: 271aa    MW: 30411.7 Da    PI: 4.933
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.5763s0021.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57344.15.8e-14102144345
               DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksi 45 
                          +qrlws eD++++LqG++dfk+k gk   +d ++fyef+k+s+
  Bostr.5763s0021.1.p 102 PQRLWSVEDDLLVLQGIVDFKTKPGKTTNEDKNGFYEFIKESL 144
                          69**************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-8103146IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MVTKTLKPSE SSSSYESSSE EDEPSSPPSA SVVAAATTGT KVSSDEEEEE DNGKQSSEED  60
ESSFEEDEPK IHKTHKRARE GTLSEDMNAG KKSETNEKKL IPQRLWSVED DLLVLQGIVD  120
FKTKPGKTTN EDKNGFYEFI KESLRRKYLN KVAKGKKPSS SKAQDLEGFE LSEKIWGSVS  180
GTYAAEESRR SKRIKKLEED KDVMILEQGG DWFSNSVLVS WVVNYGMDEV SVKRLWGCVS  240
TDKKNKMQDR WRVLQAKDVE SASQKSRVCE *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010475287.15e-55PREDICTED: mediator-associated protein 1-like
TrEMBLR0GB852e-50R0GB85_9BRAS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2048245
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-28DNA-binding storekeeper protein-related transcriptional regulator